DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Hpn

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001263198.1 Gene:Hpn / 15451 MGIID:1196620 Length:445 Species:Mus musculus


Alignment Length:264 Identity:76/264 - (28%)
Similarity:111/264 - (42%) Gaps:65/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC-TSIYEAPPKW-VRIGDLDLASEKRSV 215
            |.:|...::.::.     .:.|||||:|..:||||||| ........:| |..|    |..:.|.
Mouse   200 GRWPWQVSLRYDG-----THLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAG----AVARTSP 255

  Fly   216 EAQLLRIEQVFAHPNYKKKMYYD--------DIALLKLEKEVELTEYVRPVRLWVFPELPTT--- 269
            .|..|.::.|..|..|..  :.|        ||||:.|...:.||||::||.      ||..   
Mouse   256 HAVQLGVQAVIYHGGYLP--FRDPTIDENSNDIALVHLSSSLPLTEYIQPVC------LPAAGQA 312

  Fly   270 -----IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNA------ELPP---LAETPSGVLESQ 320
                 :....|:|.|.|.......|....:.::.|..||:      ::.|   .|..|.|.:   
Mouse   313 LVDGKVCTVTGWGNTQFYGQQAMVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGI--- 374

  Fly   321 ICAQDYILNRDTCQGDSGGPL--QLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSF 382
                      |.||||||||.  :.::.|..|     :.|.||.|:|..|. :..|.|||:|:.|
Mouse   375 ----------DACQGDSGGPFVCEDSISGTSR-----WRLCGIVSWGTGCALARKPGVYTKVTDF 424

  Fly   383 LDWI 386
            .:||
Mouse   425 REWI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/264 (29%)
Tryp_SPc 146..386 CDD:214473 74/262 (28%)
HpnNP_001263198.1 Hepsin-SRCR 78..187 CDD:255261
Tryp_SPc 190..428 CDD:214473 74/262 (28%)
Tryp_SPc 191..428 CDD:238113 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.