DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CTSG

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_011534801.1 Gene:CTSG / 1511 HGNCID:2532 Length:269 Species:Homo sapiens


Alignment Length:278 Identity:88/278 - (31%)
Similarity:123/278 - (44%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ADANDADFD--------GRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAH 189
            |:|..|..:        |.::    :||...|:||.:..:|..||  .:|||.|:.|.|||||||
Human    16 AEAGSASIELSAKCFLPGEIIGGRESRPHSRPYMAYLQIQSPAGQ--SRCGGFLVREDFVLTAAH 78

  Fly   190 CTSIYEAPPKW-----VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEV 249
            |         |     |.:|..::  ::|....|.:...:...||.|.::...:||.||:|.:.|
Human    79 C---------WGSNINVTLGAHNI--QRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRV 132

  Fly   250 ELTEYVRPVRLWVFPEL-----PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPL 309
            .....|.||.|   |..     |.|:....|:|..|..:. |:.|..:.|.|..:.:|      |
Human   133 RRNRNVNPVAL---PRAQEGLRPGTLCTVAGWGRVSMRRG-TDTLREVQLRVQRDRQC------L 187

  Fly   310 AETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSS--Y 372
            ....|.....|||..|....:...:|||||||..|       :..|    ||.|||   :||  .
Human   188 RIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCN-------NVAH----GIVSYG---KSSGVP 238

  Fly   373 PSVYTRVSSFLDWIELTV 390
            |.|:|||||||.||..|:
Human   239 PEVFTRVSSFLPWIRTTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/256 (32%)
Tryp_SPc 146..386 CDD:214473 82/255 (32%)
CTSGXP_011534801.1 Tryp_SPc 34..252 CDD:214473 81/254 (32%)
Tryp_SPc 35..255 CDD:238113 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.