DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Gzmg

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_034505.1 Gene:Gzmg / 14944 MGIID:109253 Length:248 Species:Mus musculus


Alignment Length:242 Identity:74/242 - (30%)
Similarity:118/242 - (48%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 RPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSV 215
            :|...|:||.:......|:..| |||.|:.:.||||||||.:    ....|.:|..::.:::.: 
Mouse    28 KPHSRPYMAFIKSVDIEGKKKY-CGGFLVQDDFVLTAAHCRN----RSMTVTLGAHNIKAKEET- 86

  Fly   216 EAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE-----LPTTIAFAMG 275
             .|::.:.:...||.:.:|...:||.|||||.:.:.|:.|||::|   |.     .|..:....|
Mouse    87 -QQIIPVAKAIPHPAFNRKHGTNDIMLLKLESKAKRTKAVRPLKL---PRPNARVKPGDVCSVAG 147

  Fly   276 YGATSF-AKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGG 339
            :|.||. |...:.||....|.:..:.||.......::|      :||||.|....:...:|:|||
Mouse   148 WGKTSINATKASARLREAQLIIQEDEECKKLWYTYSKT------TQICAGDPKKVQAPYEGESGG 206

  Fly   340 PLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWI 386
            ||..:        .:.|   |:.|||: .|:..|.|:|:|..||.||
Mouse   207 PLVCD--------NLAY---GVVSYGI-NRTITPGVFTKVVHFLPWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 74/242 (31%)
Tryp_SPc 146..386 CDD:214473 72/240 (30%)
GzmgNP_034505.1 Tryp_SPc 20..241 CDD:214473 72/240 (30%)
Tryp_SPc 21..244 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.