DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and F9

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:322 Identity:86/322 - (26%)
Similarity:137/322 - (42%) Gaps:57/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PGQPFPPPPGGFKKKENKQRR----LCEQKYSEYVERIFPNDT----AVAADANDA-----DFDG 146
            |..|||...........|..|    .....|....|.:|..|.    |:..:..::     ||. 
Mouse   172 PTVPFPCGRASISYSSKKITRAETVFSNMDYENSTEAVFIQDDITDGAILNNVTESSESLNDFT- 235

  Fly   147 RVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI--GD 205
            ||:    |:||:.|....:     .|:::..|||::|:|::::|||||..    |...:.:  |:
Mouse   236 RVVGGENAKPGQIPWQVIL-----NGEIEAFCGGAIINEKWIVTAAHCLK----PGDKIEVVAGE 291

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKKM--YYDDIALLKLEKEVELTEYVRPVRLWVFPELPT 268
            .::  :|:....|...:.:...|..|...:  |..|||||:|:|.:.|..||.|:  .|.....|
Mouse   292 YNI--DKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPI--CVANREYT 352

  Fly   269 TIAFAMGYGATSFAKPMTNR------LTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYI 327
            .|....|.|..|....:.|:      |..|.:.:|..|.|      |..|...:..:..||....
Mouse   353 NIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATC------LRSTTFTIYNNMFCAGYRE 411

  Fly   328 LNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC--RSSYPSVYTRVSSFLDWIE 387
            ..:|:|:||||||....:.|..       .|.||.|:|..|  :..| .:||:||.:::||:
Mouse   412 GGKDSCEGDSGGPHVTEVEGTS-------FLTGIISWGEECAMKGKY-GIYTKVSRYVNWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/256 (28%)
Tryp_SPc 146..386 CDD:214473 71/255 (28%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 71/254 (28%)
Tryp_SPc 237..467 CDD:238113 72/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.