DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and F10

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:123/275 - (44%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 VERIFPNDTAVAADAND-ADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAA 188
            :|.:..|:|.....::| ....|....:.||.|..|.:..|.:.|    .|||::::|.::||||
Mouse   224 IELLNLNETQPERSSDDLVRIVGGRECKDGECPWQALLINEDNEG----FCGGTILNEFYILTAA 284

  Fly   189 HCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTE 253
            ||  :::|....||:||.:  :||......:..::.|..|..:::..|..|||:|:|:..:....
Mouse   285 HC--LHQARRFKVRVGDRN--TEKEEGNEMVHEVDVVIKHNKFQRDTYDYDIAVLRLKTPITFRM 345

  Fly   254 YVRPVRL----WVFPELPT-TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETP 313
            .|.|..|    |....|.| ......|:|.|......:|.|..|.:..|....|.      ..|.
Mouse   346 NVAPACLPQKDWAESTLMTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCK------LSTS 404

  Fly   314 SGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYT 377
            ..:.::..||.......|.||||||||........       |::.||.|:|..| |.....:||
Mouse   405 FSITQNMFCAGYEAKLEDACQGDSGGPHVTRFKNT-------YYVTGIVSWGEGCARKGKYGIYT 462

  Fly   378 RVSSFLDWIELTVWA 392
            :|::||.||:.::.|
Mouse   463 KVTTFLKWIDRSMKA 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/246 (29%)
Tryp_SPc 146..386 CDD:214473 70/245 (29%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342
Tryp_SPc 243..471 CDD:214473 70/248 (28%)
Tryp_SPc 244..473 CDD:238113 72/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.