DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Cela2a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:247 Identity:72/247 - (29%)
Similarity:117/247 - (47%) Gaps:29/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS 214
            |.|..:|...::...|. |:..:.|||||::..:|||||||.|.|:.  ..|.:|...|::....
Mouse    37 ATPNTWPWQVSLQVLSS-GRWRHNCGGSLVANNWVLTAAHCLSNYQT--YRVLLGAHSLSNPGAG 98

  Fly   215 VEAQLLRIEQVFAHPNYKKKMYYD--DIALLKLEKEVELTEYVR----PVRLWVFPELPTTIAFA 273
            ..|  :::.::..|..:..:...:  ||||:||...|.|::.::    |....:.|.  ..:.:.
Mouse    99 SAA--VQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPR--NYVCYV 159

  Fly   274 MGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA-QDYILNRDTCQGDS 337
            .|:|.........:.|....|.||..|.|::    .:...|.|..|.:|| .|.:.:  :|.|||
Mouse   160 TGWGLLQTNGNSPDTLRQGRLLVVDYATCSS----ASWWGSSVKSSMVCAGGDGVTS--SCNGDS 218

  Fly   338 GGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY---PSVYTRVSSFLDWI 386
            ||||..      |.....:.:.||.|:|.....:|   |||:||||:::|||
Mouse   219 GGPLNC------RASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/247 (29%)
Tryp_SPc 146..386 CDD:214473 70/245 (29%)
Cela2aNP_031945.1 Tryp_SPc 30..264 CDD:214473 70/245 (29%)
Tryp_SPc 31..267 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.