DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:242 Identity:78/242 - (32%)
Similarity:118/242 - (48%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASEKRSVE 216
            |.:|..|::.:   :|:  :.||.||||.|::|:||||.:.......| |..|   :...|..:.
Human   194 GAWPWQASMQW---KGR--HYCGASLISSRWLLSAAHCFAKKNNSKDWTVNFG---IVVNKPYMT 250

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIA-----FAMGY 276
            .   :::.:..|.||.....:|||||::|.:||..|||:|.:.|   ||....::     ...|:
Human   251 R---KVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICL---PEAKMKLSENDNVVVTGW 309

  Fly   277 GATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG-VLESQICAQDYILNRDTCQGDSGGP 340
            |...........|....|.::.|..|||     :...|| |.::.:||.......|.||.|||||
Human   310 GTLYMNGSFPVILQEDFLKIIDNKICNA-----SYAYSGFVTDTMLCAGFMSGEADACQNDSGGP 369

  Fly   341 LQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            |.  .|..|.    .:||:||.|:|..| :.:.|.|||||:|:.:||
Human   370 LA--YPDSRN----IWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/242 (32%)
Tryp_SPc 146..386 CDD:214473 76/240 (32%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699
Tryp_SPc 184..410 CDD:214473 76/240 (32%)
Tryp_SPc 185..413 CDD:238113 78/242 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.