DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP001707

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_321381.5 Gene:AgaP_AGAP001707 / 1281466 VectorBaseID:AGAP001707 Length:511 Species:Anopheles gambiae


Alignment Length:408 Identity:93/408 - (22%)
Similarity:158/408 - (38%) Gaps:105/408 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 THTQRLPPEG------RMRPLQDDSIRSPVDRDIVFPELDAGPGKPEEKMWFHITDFQFDRVEGP 79
            |..|.|...|      :.:|.|:.::::||.|          |.:.::.:           |:..
Mosquito   168 TQMQPLANSGNNINAIQFQPQQNTAVQAPVYR----------PVQQQQPV-----------VQPQ 211

  Fly    80 TQPKPKPRQYP-PPPMPGQPFPPPPGGFKKKE--NKQRRLCEQKYSEYVERIFPNDTAVAADAND 141
            .||:|:|.|.| |.|:..|   .|...|...|  ......|.|.               ||..|.
Mosquito   212 PQPRPRPVQTPRPQPVQTQ---RPSVDFSSTEAGGSASIGCGQP---------------AAVFNR 258

  Fly   142 ADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDL 206
            ...:| :.:..|::|..|.:.......:..|.||.::|.||.::|||||  :|::      ||:.
Mosquito   259 LSING-IRSPKGQFPWAAPIFDTGVPAKPKYICGSTIIGERHLVTAAHC--MYDS------IGNP 314

  Fly   207 DLASEKRSV------------EAQLLRIEQVFAHPNYKKKMYYD-------DIALLKLEKEVELT 252
            ..|::..:|            :.|...::::|.|.:|    |::       |||::.:::.:...
Mosquito   315 RSANDLTTVPGMHNIDNFFDADLQERSVKKIFIHEDY----YFEDSILLDTDIAVMLIDQPLTYN 375

  Fly   253 EYVRPVRLWV----FPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETP 313
            ..|||:.||.    ..::.....|..|:|.|....  ....:.:..|||....|...|..|....
Mosquito   376 NLVRPICLWQESDNLEQIVGQKGFVSGWGVTEDGN--AKYPSYVTATVVDRRTCTRNLERLIAGN 438

  Fly   314 SGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF------CRSSY 372
            :.:    .||..:  ....|.||||..|.:     :||.|  |::.||.|.|.:      |....
Mosquito   439 ARI----FCADGH--GSVPCTGDSGSGLVI-----KRGSR--YYIRGIVSVGQYDPNTLTCARDK 490

  Fly   373 PSVYTRVSSFLDWIELTV 390
            ..:||.::.|..|:...|
Mosquito   491 YVLYTDIAPFRYWLSRVV 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 64/269 (24%)
Tryp_SPc 146..386 CDD:214473 63/268 (24%)
AgaP_AGAP001707XP_321381.5 GD_N 50..150 CDD:292649
Tryp_SPc 261..507 CDD:238113 64/273 (23%)
Tryp_SPc 261..503 CDD:214473 63/269 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.