DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP001964

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_321098.5 Gene:AgaP_AGAP001964 / 1281159 VectorBaseID:AGAP001964 Length:363 Species:Anopheles gambiae


Alignment Length:316 Identity:80/316 - (25%)
Similarity:130/316 - (41%) Gaps:60/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FKKKENKQRRLCEQKYSEYVERIF-------PNDTAVAADANDADFDGRV------LARPGEYPH 157
            |.:..:::.|....|...: |||.       |::..:...|.:.:..|.|      .|:.||:|.
Mosquito    61 FDRSSSEECRFPHLKCCPF-ERIVRAPDTEAPDEAEIVCAARNNNGIGHVEQKDKTRAKYGEFPW 124

  Fly   158 MAAVGFESDRGQVDYK---CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQL 219
            ||.|    ...|.||:   |||:|:..:.|:|.|||.....|....||:|:.||.........|.
Mosquito   125 MAFV----YTAQADYELYLCGGTLVHSKVVITIAHCIENRTASELRVRLGEWDLEHMVEIYPPQD 185

  Fly   220 LRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF------AMGYGA 278
            ..:.....||.:..::..:|||:|.|::.|:.||.   |.:...|  |....|      ..|:|.
Mosquito   186 RAVIAAVTHPQFYSELLLNDIAILFLDEHVDFTEV---VGIACLP--PQNANFDHKRCLFTGWGE 245

  Fly   279 TSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILN-----------RDT 332
            ....: .::.|....|.:|||.:|..           ||...:..:.:.|:           :|.
Mosquito   246 DERGR-NSSVLKRTKLPIVPNGQCQR-----------VLRRHLLNRSFRLHQGFLCAGGESGKDA 298

  Fly   333 CQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            |:||.|.||...:|....    .|:::|:.::|..| ....|.||..|..:.|||:
Mosquito   299 CRGDGGSPLVCPIPQSEN----QYYVVGLVAFGYECGTQGVPGVYVNVPHYRDWID 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/267 (27%)
Tryp_SPc 146..386 CDD:214473 70/266 (26%)
AgaP_AGAP001964XP_321098.5 Tryp_SPc 117..350 CDD:238113 69/257 (27%)
Tryp_SPc 117..349 CDD:214473 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.