DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:277 Identity:101/277 - (36%)
Similarity:143/277 - (51%) Gaps:28/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISE 181
            ||.:   |...::| |..:::.:.         |.|||:.|:||:|:....|.|.:|||||||.|
Mosquito     5 CELR---YFRSVYP-DQFISSGSP---------AFPGEFAHIAAIGWTQPDGTVQWKCGGSLIWE 56

  Fly   182 RFVLTAAHCTSIYEAP-----PKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIA 241
            .::||||||   |..|     |..:|||||:|.........|..:|.|:..||.:.....|.|:|
Mosquito    57 NYILTAAHC---YADPDTILSPDVIRIGDLNLFDADDDEFVQERKIVQIIRHPLHNASTVYYDLA 118

  Fly   242 LLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAEL 306
            ||||:|:|..:|.|.|..||:...:|.:.....|:|.|.|.|..:|.|....|.::.|.||....
Mosquito   119 LLKLDKKVIQSEGVIPTCLWLDDSIPFSTLEVAGWGQTGFGKEKSNMLLKAELKLMTNTECAKYN 183

  Fly   307 PPLAETPSG--VLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR 369
            ....:...|  :.:.|:||.|.::  |||.|||||||..||..:   |.....|:|:||:|..|.
Mosquito   184 NKRTQRRLGNDLADHQLCAWDEVM--DTCPGDSGGPLHYNLYYK---HTKIPFLVGVTSFGKACA 243

  Fly   370 SSYPSVYTRVSSFLDWI 386
            .|.|.||.:|:.|..||
Mosquito   244 VSQPGVYVKVAKFKQWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 96/248 (39%)
Tryp_SPc 146..386 CDD:214473 94/246 (38%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 96/259 (37%)
Tryp_SPc 19..260 CDD:214473 94/257 (37%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.