DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPA7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_320723.2 Gene:CLIPA7 / 1280856 VectorBaseID:AGAP011792 Length:821 Species:Anopheles gambiae


Alignment Length:259 Identity:85/259 - (32%)
Similarity:121/259 - (46%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DFDGRVLARPGEYPHMAAVGFES---DRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIG 204
            |.||.  :..||:|.|.|:..|.   |:....|:||||||....|||||||....:.....||:|
Mosquito   560 DNDGE--SEYGEFPWMVAILKEEKALDQVINVYQCGGSLIHPSVVLTAAHCVQNRKIEEVKVRLG 622

  Fly   205 DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFP----E 265
            :.|..::....:.|...:.::.:|....|...::|:|||.|:|..:|.|.|..:.|   |    .
Mosquito   623 EWDTQTKNEMFDYQDRNVVEIVSHAEIYKGGLFNDVALLFLDKPADLMETVNTICL---PPANHN 684

  Fly   266 LPTTIAFAMGYGATSFAKPMTNR--LTNLNLTVVPNAECNAELPPLAETPSG----VLESQICAQ 324
            ...:..||.|:|...|.|..|.:  |..:.|.::||.||.   ..|..|..|    :..|.|||.
Mosquito   685 FDMSRCFASGWGKDVFGKQGTYQVILKKIELPIMPNEECQ---KALRTTRLGRRFKLHSSFICAG 746

  Fly   325 DYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            .. ..||||:||.|.||...:||...    ||:..|:.::|:.| ....|.||..|..|..||:
Mosquito   747 GE-KGRDTCKGDGGSPLICPIPGSVN----HYYQAGMVAWGIGCGEDGIPGVYVNVPMFRGWID 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/254 (32%)
Tryp_SPc 146..386 CDD:214473 81/253 (32%)
CLIPA7XP_320723.2 BAT2_N <406..487 CDD:284431
Tryp_SPc 556..804 CDD:214473 83/256 (32%)
Tryp_SPc 564..807 CDD:238113 82/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.