DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:122 Identity:39/122 - (31%)
Similarity:56/122 - (45%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 AMGYGATSFAKP--MTNRLTNLNLTVVPNAECNAELPPLAETPSG----VLESQICAQDYILNRD 331
            |.|:|...|...  :...:..:.|.:||...|..   .|..|..|    :.||.:||... ..||
Mosquito    23 ASGWGKDVFGNEGMLQVIMKKVELPLVPRGACQR---ALRTTHLGRQFKLHESFVCAGGE-KGRD 83

  Fly   332 TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            ||:||.|.||...:||...|    |:..||.::|:.| :...|.||..|:.|.:||:
Mosquito    84 TCKGDGGSPLVCPIPGVANG----YYQAGIVAWGIDCGKEGIPGVYVNVALFREWID 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 38/120 (32%)
Tryp_SPc 146..386 CDD:214473 37/119 (31%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 39/122 (32%)
Tryp_SPc <2..135 CDD:214473 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.