DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP012270

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_320269.4 Gene:AgaP_AGAP012270 / 1280418 VectorBaseID:AGAP012270 Length:862 Species:Anopheles gambiae


Alignment Length:263 Identity:72/263 - (27%)
Similarity:114/263 - (43%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS 214
            |.||.:|..|.: ::...|..:||||||:|.|..:||:.||          |.:|...::.|:.|
Mosquito    46 AMPGHWPWHAVI-YQRANGAEEYKCGGSIIDEDTILTSGHC----------VTVGSRAISPEQLS 99

  Fly   215 VEAQLLR------------IEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELP 267
            :|...:|            :.||..||....:.:.:||||:||...:.:|.:|:|:.||......
Mosquito   100 IEVGRIRLHERTEYTQTHGVRQVIVHPGLNVRRFKNDIALIKLASNITMTPHVQPICLWTMDNNQ 164

  Fly   268 TTI----AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYIL 328
            ..|    ...:|:|.|. ...::.:|...::.||....|.|.  ..|...:.:.....|..    
Mosquito   165 ELIVGKNGTVLGFGLTE-QDVVSEQLKQASIGVVDTLTCLAN--DRAAFGTYLTSEMFCGG---- 222

  Fly   329 NRD---TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY------GVFCRSSYPSVYTRVSSFLD 384
            .||   .|.|||||.|.|.:.||       :.:.||.|:      ...|.:|..:.:..|:.:|.
Mosquito   223 GRDGVSACNGDSGGGLFLEVEGR-------WFVRGIVSFIPLRKNTALCDTSKFTAFADVAKYLK 280

  Fly   385 WIE 387
            |||
Mosquito   281 WIE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/261 (27%)
Tryp_SPc 146..386 CDD:214473 69/260 (27%)
AgaP_AGAP012270XP_320269.4 Tryp_SPc 40..284 CDD:238113 72/263 (27%)
Tryp_SPc 42..282 CDD:214473 69/260 (27%)
Tryp_SPc 329..>443 CDD:304450
Tryp_SPc 614..842 CDD:304450
Tryp_SPc 614..839 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.