DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP009252

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_320033.4 Gene:AgaP_AGAP009252 / 1280210 VectorBaseID:AGAP009252 Length:460 Species:Anopheles gambiae


Alignment Length:291 Identity:73/291 - (25%)
Similarity:127/291 - (43%) Gaps:66/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYK----CGGSLI 179
            ::..|...||    .|.:...|:|.|:...::.    |::..||:   ||..|.|    |.|:||
Mosquito   219 RELDECAHRI----KASSGSTNEAQFETGYISE----PYLVEVGW---RGNGDAKAQWSCRGTLI 272

  Fly   180 SERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLK 244
            :.:.|||:|.|.......|..:|:| |:.|       |.::.:|:...||.:......::|||:|
Mosquito   273 TSKAVLTSAKCLQQQSIAPSVIRLG-LNEA-------APVVNVEETILHPEFDVASGKNNIALIK 329

  Fly   245 LEKEV-ELTEYVRPVRLW----------VFPEL-PTTIAFAMGYGATSFAKPMTNRLTNLNLTVV 297
            ::..: :.|..:.|..||          :.|.: .:|:..|:.:  |.|                
Mosquito   330 MKDAIDQSTIAINPACLWKNQTHTPFEMIQPVIKESTLGPALAF--TKF---------------- 376

  Fly   298 PNAECNAELPPLAETPSGVLESQICAQ-DYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGI 361
             |::|:.......:      |.::|.. :.:...||  |||||.||:.|   ....::...::.:
Mosquito   377 -NSDCDRTFRRTLD------EHELCVDVEQLPYMDT--GDSGGRLQVKL---LHNAKVTPFVVAV 429

  Fly   362 TSYGVFCRSSYPSVYTRVSSFLDWIELTVWA 392
            ||:|..|..|.|.|||:||.:..||...:.|
Mosquito   430 TSFGSACGQSTPGVYTKVSKYAPWIRSVIAA 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 64/257 (25%)
Tryp_SPc 146..386 CDD:214473 63/256 (25%)
AgaP_AGAP009252XP_320033.4 Tryp_SPc 248..457 CDD:304450 65/249 (26%)
Tryp_SPc 248..454 CDD:214473 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.