DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP008891

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_319638.4 Gene:AgaP_AGAP008891 / 1279859 VectorBaseID:AGAP008891 Length:395 Species:Anopheles gambiae


Alignment Length:359 Identity:128/359 - (35%)
Similarity:178/359 - (49%) Gaps:76/359 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VDRDIVF-PELDAGPGKPEEKMWFHITDFQFDRVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFK 107
            |||.|:| |.|.:.....:..::.|               :| |.||.|             |..
Mosquito     1 VDRMILFLPILLSLASLAQGSVFLH---------------RP-PLQYTP-------------GNS 36

  Fly   108 KKENKQRRLCEQKY--SEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQV 170
            ..|      |||::  ::|...|.|   ||:.        || .|..||:|||||:|:......|
Mosquito    37 LDE------CEQRFPNNQYEPEIVP---AVSG--------GR-RAFQGEFPHMAAIGWTRTDAPV 83

  Fly   171 DYKCGGSLISERFVLTAAHCTS-IYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKK 234
            ||.||||||:.:||||||||:: :...||..||:.|.||||......||.:.|.::..||.|:..
Mosquito    84 DYLCGGSLITWKFVLTAAHCSADLDNIPPDTVRLADTDLASTSDDEFAQQIPIARIIKHPQYRWS 148

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVR------LWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLN 293
            ..|.|||:      |||.|||:|.:      ||..|.:|..:..|:|:||..|.:.:::.|..:.
Mosquito   149 RKYYDIAV------VELEEYVKPNKVICVACLWREPNVPGDLMDAVGFGALGFGERLSSTLQKIK 207

  Fly   294 LTVVPNAECNAELPPL-AETPSGVLESQICAQDYILNRDTCQGDSGGPLQ---LNLPGRRRGHRI 354
            |..:....|...||.: .|.|.|:.:.|:||....:  |||:||||||||   .:|.|:.     
Mosquito   208 LQALDETICAKRLPAMRREMPEGLRDDQLCAHSATM--DTCEGDSGGPLQTDRTDLLGKT----- 265

  Fly   355 HYHLI-GITSYGVFCRSSYPSVYTRVSSFLDWIE 387
             |.|| |:.::|..|.:....|||||||:|||||
Mosquito   266 -YALIVGVVAFGTPCTNGSTGVYTRVSSYLDWIE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 103/252 (41%)
Tryp_SPc 146..386 CDD:214473 102/251 (41%)
AgaP_AGAP008891XP_319638.4 Tryp_SPc 57..297 CDD:214473 103/262 (39%)
Tryp_SPc 59..299 CDD:238113 105/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.