DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG43335

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:249 Identity:75/249 - (30%)
Similarity:118/249 - (47%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS---VE 216
            :|.||.:     ..:..|.|.|:||:.:||||||||  |..:....||:|...|.....|   :.
  Fly    53 HPWMAYL-----YNEFHYFCAGTLITNQFVLTAAHC--IEASKNLTVRLGGSGLTRSDGSMCQIT 110

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSF 281
            |:...:.....|..:...:..:|||:::|.:.|:..:::||:.:.:.|.:...:...|...||.:
  Fly   111 AEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGW 175

  Fly   282 A---KPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQL 343
            .   |.|...|.......|.|....::|..:|     :.:.||||.|...|  ||.|||||||  
  Fly   176 GLADKRMHPHLLQEAPITVMNRNVCSKLYDVA-----ITQGQICAGDKETN--TCLGDSGGPL-- 231

  Fly   344 NLPGRRRGHRIHYH------LIGITSYG-VFCRSSYPSVYTRVSSFLDWIELTV 390
                   |..::|:      ..||||:| :.|||  ||:||.:|::..||.:.|
  Fly   232 -------GGVVNYYGDLRFVQYGITSFGDIECRS--PSIYTDLSTYSGWINMVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/244 (30%)
Tryp_SPc 146..386 CDD:214473 72/243 (30%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 72/243 (30%)
Tryp_SPc 42..275 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.