DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG43110

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:227 Identity:70/227 - (30%)
Similarity:102/227 - (44%) Gaps:47/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYD 238
            |||::|.|.||||.|||.|   ....:||:|..::     :.....:|:.:..|||.|....|.:
  Fly    61 CGGTIIHEDFVLTVAHCKS---TQTLFVRLGAYNI-----NHPTDQIRVIETIAHPQYSNSTYAN 117

  Fly   239 DIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF--AMGYGATSFAKP-------MTNR----LT 290
            ||||:|||:.|.....::|:.:.:...|...|.:  |.|:|.|..|:.       ..||    :.
  Fly   118 DIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMIC 182

  Fly   291 NLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIH 355
            :|.|.:.|:.:                  ||||...  ..|||.|||||||...:..:.:.....
  Fly   183 HLYLGMSPDPK------------------QICATTD--QGDTCAGDSGGPLISKITYQGKNFDTQ 227

  Fly   356 YHLIGITSYGV-FCRSSYPSVYTRVSSFLDWI 386
            :   ||||||. .|..  ..:||.||.:..||
  Fly   228 F---GITSYGTRECNG--VGLYTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/227 (31%)
Tryp_SPc 146..386 CDD:214473 68/225 (30%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 68/225 (30%)
Tryp_SPc 36..257 CDD:238113 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.