DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG43125

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:230 Identity:62/230 - (26%)
Similarity:99/230 - (43%) Gaps:59/230 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS-VEAQLLRIEQVFAHPNYKKKMYY 237
            |.|:||:||||||||.|.. |:. ...||:|::|...:..| ::.:.:.:.:...|.:|..:.:.
  Fly    52 CTGTLINERFVLTAASCID-YQT-ELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQ 114

  Fly   238 DDIALLKLEKEVELTEYVRPVRLWV----FPELPTTIAFAMGYGATSFAKPMTN------RLTN- 291
            .:||||:|:..|...:.::|:.:.|    .|:.||   |.:......  :|..|      |..| 
  Fly   115 YNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPT---FEIEKKKNE--EPKKNKAGIMKRFLNW 174

  Fly   292 -LNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPL--QLNLPGRRRGHR 353
             |:|..|.....:..|||   .|..|                     |.||  |:|       ..
  Fly   175 FLSLFGVREPRPDVILPP---QPIAV---------------------GWPLTKQIN-------ES 208

  Fly   354 IHYHLIGITSYGVFCRS--SYPSVYTRVSSFLDWI 386
            ..:|..||.|:    |:  |...|||.|.::::||
  Fly   209 ALFHQYGILSH----RNSESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 62/230 (27%)
Tryp_SPc 146..386 CDD:214473 60/228 (26%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.