DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:250 Identity:81/250 - (32%)
Similarity:122/250 - (48%) Gaps:45/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQ 218
            :||:..::    .||:  :.||.|:|..:::|||||||....|...|:.:|...:.....||   
Mosquito    56 DYPYQVSL----RRGR--HFCGESIIDSQWILTAAHCTRTINARNLWIHVGSSHVNDGGESV--- 111

  Fly   219 LLRIEQVFAHPNYKKKMYYD-DIALLKLEKEVELTEYVRPVRLWVFPEL--PT------TIAFAM 274
              |:.::..||  |:..:.| |.:||.|::.:.|:|.|:|:.|.. |..  ||      |:....
Mosquito   112 --RVRRILHHP--KQNSWSDYDFSLLHLDQPLNLSESVQPIPLRK-PSASEPTGELSDGTLCKVS 171

  Fly   275 GYGATSFAKPMTNRLTNLNLTVVP---NAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGD 336
            |:|.|.  .|..:.|. |....||   :.:|:    .:.|....|.||.|||......:|:||||
Mosquito   172 GWGNTH--NPDESALV-LRAATVPLTNHQQCS----EVYEGIGSVTESMICAGYDEGGKDSCQGD 229

  Fly   337 SGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            |||||..:  |:         |.|:.|:|..| ...||.||.:||:..:|||.||
Mosquito   230 SGGPLVCD--GQ---------LTGVVSWGKGCAEPGYPGVYAKVSTAYEWIEQTV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/245 (31%)
Tryp_SPc 146..386 CDD:214473 76/244 (31%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 76/244 (31%)
Tryp_SPc 46..272 CDD:238113 79/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.