DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPB15

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_318957.5 Gene:CLIPB15 / 1279262 VectorBaseID:AGAP009844 Length:364 Species:Anopheles gambiae


Alignment Length:322 Identity:97/322 - (30%)
Similarity:146/322 - (45%) Gaps:63/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPH 157
            ||..:|.|              .||..|:|.       :.|..|....|..:.|....| |.:|.
Mosquito    78 PMRKKPIP--------------LLCCPKFSN-------SPTCGAQQLADRIYFGEETER-GAHPW 120

  Fly   158 MAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW----VRIGDLDLASEKRSV--- 215
            .|.:.:...|.:...||||:|||||:|:||||||   ...|.|    ||..:.:.:|.....   
Mosquito   121 AALLFYNVGRNRTVPKCGGALISERYVITAAHCT---VDKPNWKLLYVRFNEFNTSSADNCTTEN 182

  Fly   216 EAQLLR----IEQVFAHPNYKKKMYY----DDIALLKLEKEVELTEYVRPVRLWVFP---ELPTT 269
            :..:.|    :|.:..||.|  .|:.    :||.:|:|..:|...:||||:.|...|   :||..
Mosquito   183 DEVICREDYAVESIVPHPEY--DMHNISRPNDICILRLASDVTFNDYVRPICLPFDPDVQQLPIV 245

  Fly   270 --IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILN-RD 331
              |....|:|.|...:| ::...::.|..:.:..||:.......|.|   :.|:|...  || .|
Mosquito   246 DEIFTVTGWGETEDRRP-SDTQKHVELPGLEHEACNSVYAVANVTLS---DKQLCIGG--LNGSD 304

  Fly   332 TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGV-FC-RSSYPSVYTRVSSFLDWIELTVW 391
            :|:|||||||...:.|       .:.|||:.|:|. || ..:.|.|||.|:.:|||:|..::
Mosquito   305 SCRGDSGGPLMREVRG-------GWFLIGVVSFGARFCGTQNLPGVYTNVAKYLDWMETVMF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 85/263 (32%)
Tryp_SPc 146..386 CDD:214473 84/262 (32%)
CLIPB15XP_318957.5 CLIP 31..90 CDD:197829 6/25 (24%)
Tryp_SPc 110..353 CDD:238113 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.