DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP009828

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_318940.4 Gene:AgaP_AGAP009828 / 1279246 VectorBaseID:AGAP009828 Length:232 Species:Anopheles gambiae


Alignment Length:245 Identity:64/245 - (26%)
Similarity:102/245 - (41%) Gaps:40/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVE 216
            ||..|::.|:...|....:   |.|.||...::||.|.|.:...|....:..|...|.:.|    
Mosquito    15 PGAAPYIVAIKTTSASTLL---CAGVLIKTTWILTTAQCVNDKTAADLKILTGSHRLLTSK---- 72

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSF 281
             :||.|.::..||:||......::|||:|...|.|:..|..|.|...|.:........|:||:|:
Mosquito    73 -ELLLISKIERHPSYKPASSEYNLALLQLSAAVSLSSRVATVVLNDEPIISGIPVVFFGWGASSY 136

  Fly   282 AK-PMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE---SQIC--AQDYILNRDTCQGDSGGP 340
            .. ..:|.|.:|....:..::|.|:        ||:::   ..||  .|.   .:..|..|..||
Mosquito   137 GSLAYSNVLQSLYKRTLSTSDCRAQ--------SGLVDLSADNICTIGQP---GQAACTHDEAGP 190

  Fly   341 LQLNLPGRRRGHRIHY---HLIGITSYGVFCRSSYPSVYTRVSSFLDWIE 387
            |            :.|   .|:|:.:||..|....|.|:..|.:...||:
Mosquito   191 L------------VRYDTQKLVGLFNYGSQCTGRSPDVFVNVLTHKTWID 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 63/243 (26%)
Tryp_SPc 146..386 CDD:214473 62/242 (26%)
AgaP_AGAP009828XP_318940.4 Tryp_SPc 7..230 CDD:238113 64/245 (26%)
Tryp_SPc 7..227 CDD:214473 62/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.