DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP004741

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_318080.4 Gene:AgaP_AGAP004741 / 1278484 VectorBaseID:AGAP004741 Length:315 Species:Anopheles gambiae


Alignment Length:285 Identity:76/285 - (26%)
Similarity:126/285 - (44%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TAVAADANDADFDGRVL---------ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAA 188
            ||:....:||....|.|         |..|::|..|::  .:..|:....||||||..::|||||
Mosquito    51 TAIPIPRHDAPRTVRELLAKVVNGQTATTGQFPWQASI--RAALGRSVTVCGGSLIEAQWVLTAA 113

  Fly   189 HCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTE 253
            ||.:.|..  ..:.:|.:.|...:.::...:     .|.||.:......:|:||::|...|..:.
Mosquito   114 HCANDYTV--FQIGLGSIHLNMARLTMSTVI-----KFVHPEFDPWKLTNDVALIRLPSPVPYSL 171

  Fly   254 YVRPVRLWVFPELPTTIAF------AMGYGATSFA-KPMTNRLTNLNLTVVPNAEC----NAELP 307
            .:.||:|.:  .||.|..:      ..|:|.||.| :.::..|....:.::.||||    .|.: 
Mosquito   172 EIYPVKLPI--NLPPTDLYIGRQVTVSGFGRTSDAIQSISTILKYERMRIISNAECTNVYGAAI- 233

  Fly   308 PLAETPSGVLESQICA----QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY---- 364
                    :..:.:||    :.|   ::.||||||||:.:.....      .:..|||.|:    
Mosquito   234 --------IRNTTLCAVGWERPY---QNVCQGDSGGPMVMQQDDS------SWVQIGIVSFVSSR 281

  Fly   365 GVFCRSSYPSVYTRVSSFLDWIELT 389
            |  |.:..||.|.|..::|.|:..|
Mosquito   282 G--CSTGDPSGYIRTVNYLSWLAKT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/268 (26%)
Tryp_SPc 146..386 CDD:214473 70/267 (26%)
AgaP_AGAP004741XP_318080.4 Tryp_SPc 70..300 CDD:214473 68/260 (26%)
Tryp_SPc 71..304 CDD:238113 69/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.