DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TRY1_ANOGA

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_317170.2 Gene:TRY1_ANOGA / 1277688 VectorBaseID:AGAP008296 Length:274 Species:Anopheles gambiae


Alignment Length:241 Identity:76/241 - (31%)
Similarity:113/241 - (46%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GFESDRGQVDYK----------CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVE 216
            |||.|.....|:          ||||::|.::||||||||:........||:|     :.:.:..
Mosquito    51 GFEIDVSDAPYQVSLQYNKRHNCGGSVLSSKWVLTAAHCTAGASPSSLTVRLG-----TSRHASG 110

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTI-----AFAMGY 276
            ..::|:.:|..||.|.......|.:||:||.|:..::.|:||.|   |:...|:     ....|:
Mosquito   111 GTVVRVARVVQHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGL---PKQDETVKDGTMTTVSGW 172

  Fly   277 GATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPL 341
            |.|..|......|...|:..|...|||......    .||.:..:||......:|.|||||||||
Mosquito   173 GNTQSAAESNAVLRAANVPTVNQKECNKAYSEF----GGVTDRMLCAGYQQGGKDACQGDSGGPL 233

  Fly   342 QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ..:  |:         |:|:.|:|..| ::.||.||:||:...||:
Mosquito   234 VAD--GK---------LVGVVSWGYGCAQAGYPGVYSRVAVVRDWV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/241 (32%)
Tryp_SPc 146..386 CDD:214473 75/239 (31%)
TRY1_ANOGAXP_317170.2 Tryp_SPc 47..268 CDD:214473 75/239 (31%)
Tryp_SPc 48..271 CDD:238113 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.