DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP008403

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_317049.4 Gene:AgaP_AGAP008403 / 1277577 VectorBaseID:AGAP008403 Length:873 Species:Anopheles gambiae


Alignment Length:244 Identity:98/244 - (40%)
Similarity:143/244 - (58%) Gaps:18/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 RPG---EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTS-IYEAPPKWVRIGDLDLASE 211
            ||.   |:.||||||:..:.|::|:.||||||.|.:||||||||: ...|.|..||:||::|..:
Mosquito    21 RPAYLREFAHMAAVGWTGENGKIDWNCGGSLIWENYVLTAAHCTADDNNAAPDVVRLGDINLDDD 85

  Fly   212 KRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGY 276
            .....||.|:|.::..||.::....|.|:|||:||:.|.|.:.|.|..||...|:|.....|.|:
Mosquito    86 SDDKYAQQLKIVEIIRHPEHRFSSRYHDLALLRLERNVTLHDTVAPGCLWNDEEIPFPSMEATGW 150

  Fly   277 GATSFAKPMTNRLTNLNLTVVPNAECNAELPP----LAETPSGVLESQICAQDYILNRDTCQGDS 337
            |:|.|||  |..|..::|::||.:.|:.:...    |.:   |:.:.|:||.|  :..|||.|||
Mosquito   151 GSTGFAK--TPILLKVSLSLVPKSTCDQQYRKGDRGLRQ---GLQDYQLCAGD--IKMDTCPGDS 208

  Fly   338 GGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWI 386
            |||||:.|....   ::...:|.:||:|..|..|.|.||.:||.::.||
Mosquito   209 GGPLQMKLLANA---KMTPFIIAVTSFGSVCGQSTPGVYMKVSPYIPWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 98/244 (40%)
Tryp_SPc 146..386 CDD:214473 96/242 (40%)
AgaP_AGAP008403XP_317049.4 Tryp_SPc 20..256 CDD:238113 98/244 (40%)
Tryp_SPc 20..254 CDD:214473 96/242 (40%)
Tryp_SPc 324..552 CDD:304450
CLIP 577..617 CDD:295450
Tryp_SPc 656..872 CDD:304450
Tryp_SPc 656..869 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.