DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005670

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_315687.1 Gene:AgaP_AGAP005670 / 1276350 VectorBaseID:AGAP005670 Length:300 Species:Anopheles gambiae


Alignment Length:254 Identity:75/254 - (29%)
Similarity:111/254 - (43%) Gaps:39/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAV--GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEK 212
            |.||::|:..|:  .|.:..|    .||||:::..::||||||  :........|.|...:.:..
Mosquito    61 ATPGQFPYQIALLSEFLTGTG----LCGGSVLTNNYILTAAHC--VVSGATTLARGGTAIMGAHN 119

  Fly   213 RSV---EAQLLRIEQ--VFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF 272
            |:|   ..|.:|...  :..||.|......:|||:::|:..:.....|:|.||   |....|..|
Mosquito   120 RNVNEPSQQRIRFSTGGIIRHPQYTTTNIRNDIAVVRLDAPIVFNTRVQPARL---PARSDTRQF 181

  Fly   273 ------AMGYGATSFAKPMTNRLTNLNLT-VVPNAECNAELPPLAETPSGVLESQICAQDYILNR 330
                  ..|:|..|.....|:.:...... |:.||:|      :|...:.:::.|.........|
Mosquito   182 GGFTGTVSGFGRVSDGSTATSAVVRFTSNPVMTNADC------IARWNTALIQPQNVCLSGEGGR 240

  Fly   331 DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF--CRSSYPSVYTRVSSFLDWIE 387
            ..|.|||||||.:...|..:        |||.|:|..  |....||||.|||.||.|||
Mosquito   241 SACNGDSGGPLAVQDGGSLQ--------IGIVSFGSAGGCSIGMPSVYARVSFFLSWIE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/252 (29%)
Tryp_SPc 146..386 CDD:214473 72/251 (29%)
AgaP_AGAP005670XP_315687.1 Tryp_SPc 54..290 CDD:214473 72/251 (29%)
Tryp_SPc 55..293 CDD:238113 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.