DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005664

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_315684.2 Gene:AgaP_AGAP005664 / 1276347 VectorBaseID:AGAP005664 Length:306 Species:Anopheles gambiae


Alignment Length:293 Identity:83/293 - (28%)
Similarity:129/293 - (44%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QKYSEYVERIFPNDTAVAADANDADFDGRVL----ARPGEYPHMAAV--GFESDRGQVDYKCGGS 177
            :::..|..|: |.:..:...|..:.   ||:    |.||::|:..|:  .|....|    .||||
Mosquito    36 EEFDHYWARL-PQELQIYRYAQPSH---RVVNGQEATPGQFPYQIALLSNFLIGTG----LCGGS 92

  Fly   178 LISERFVLTAAHC----TSIYEAPPKWVRIGDLDLASEKRSV---EAQLLRIEQ--VFAHPNYKK 233
            :::..:|||||||    ||.....      |:..:.:..|..   ..|::....  :.|||.|..
Mosquito    93 VLTNNYVLTAAHCVIMGTSTVALG------GNAIMGAHNRDAPEPSQQIIAFTSAGISAHPGYSS 151

  Fly   234 KMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF------AMGYGATSFAKPMTNRLTNL 292
            ....:|||:::|...:..|:.::|.||   |....|..|      ..|:|.||.|...|:.:...
Mosquito   152 ANIRNDIAVVRLNSPITFTDRIQPARL---PARSDTRQFGGFTGTVSGFGRTSDASQATSSVVMF 213

  Fly   293 NLT-VVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHY 356
            ... |:.||:|      :|:..:.::|.|.........|..|.|||||||.:...|..:      
Mosquito   214 TSNPVMTNADC------IAQWNAVLIEPQNVCMSGEGGRSACNGDSGGPLAVQDGGSLQ------ 266

  Fly   357 HLIGITSYG--VFCRSSYPSVYTRVSSFLDWIE 387
              :|:.|:|  ..|....||||.|||.|||:||
Mosquito   267 --VGVVSFGSAAGCAIGMPSVYARVSFFLDFIE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/264 (29%)
Tryp_SPc 146..386 CDD:214473 77/263 (29%)
AgaP_AGAP005664XP_315684.2 Tryp_SPc 60..296 CDD:214473 77/262 (29%)
Tryp_SPc 61..299 CDD:238113 78/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.