DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP004644

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_315161.5 Gene:AgaP_AGAP004644 / 1275879 VectorBaseID:AGAP004644 Length:410 Species:Anopheles gambiae


Alignment Length:363 Identity:85/363 - (23%)
Similarity:133/363 - (36%) Gaps:139/363 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVG-FESDRGQVDYKCGGSLISERFVLTAAHC--TSIYE--APPKW-VRIGDLDLASE 211
            |:||...::. .....|.:.:.|||.||...:||:||||  ..::.  .|..| |.:|:.|..||
Mosquito    59 GQYPWQVSLELLHPSYGFIGHWCGGVLIDRNWVLSAAHCIHNDLFNLPLPALWTVLLGEYDRRSE 123

  Fly   212 KRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKE--------------------VELTEY-V 255
              |...|.:.::::..|..|:.  :..|:.||||.|.                    |....| |
Mosquito   124 --SGFEQRIPVDKIILHEKYQN--FKHDLVLLKLGKSANTSPNSRIRKICLPFADFTVNSMPYDV 184

  Fly   256 RPVRLWVFPELPTTIAFAMGY-------------------------------------------- 276
            ||.:     :|.....:..||                                            
Mosquito   185 RPTQ-----QLKQDANYKPGYYFDVEQTKYLINQLVAGRLRSHLTNRTSSDLANDQTVLKTSNNA 244

  Fly   277 --GATSFAKPMTNRLTNLNLTVVPN------------------------AECNA----------E 305
              |..|.::..:.||.::::..|.|                        .:|.|          |
Mosquito   245 LSGRLSESRRSSRRLFSVDMFKVDNTHFASVAQTDHGSPTNALPDTSQYVDCLATGWGKSTIDDE 309

  Fly   306 LPP-LAETPSGVLESQICAQ---DYI-LNR------------DTCQGDSGGPLQLNLPGRRRGHR 353
            |.. |.:|.:.:..::.|.:   |:| |:|            .||.||||||||..:  .:||..
Mosquito   310 LTDVLLQTRAPIQSTKKCEEAYGDFIKLHRGHLCAGNLDGAGGTCVGDSGGPLQCRI--SKRGPW 372

  Fly   354 IHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIELTV 390
            :   |:||||:|..|. .:||.|||::|.:..||..|:
Mosquito   373 V---LVGITSFGSGCAFKNYPDVYTKISFYRQWIVDTI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/358 (23%)
Tryp_SPc 146..386 CDD:214473 82/357 (23%)
AgaP_AGAP004644XP_315161.5 Tryp_SPc 49..403 CDD:214473 82/357 (23%)
Tryp_SPc 50..406 CDD:238113 84/360 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.