DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:246 Identity:60/246 - (24%)
Similarity:108/246 - (43%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC-TSIYEAPPKWVRIGDLDLASEKRSVE 216
            |:.|::|.:.:.:   ...| ||||:|:.|::|||||| |::.......||:|..|      :.|
Mosquito    44 GKAPYLAGLVYNN---SATY-CGGSIIAARWILTAAHCVTNVNVTNLTVVRVGTND------NYE 98

  Fly   217 -AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL--WVFPELPTTIAFAMGYGA 278
             ..:.:|::|..|..|....:.:|:|||:|:..::..|:|..:.|  .:.| :..|:.. :|:|.
Mosquito    99 GGSMYQIDRVIPHERYSAITFRNDVALLRLKTPIKFEEHVEKIELNEELVP-INATLTI-VGWGF 161

  Fly   279 TSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQL 343
            ..:.|....|...:.:..:....|..     ....|.:....:|.... .....|:||||.|:..
Mosquito   162 VGWNKENPKRTQVIKVQHIGLNRCRK-----MANGSAIYPEHLCTFSR-AGHGPCKGDSGSPVVW 220

  Fly   344 NLPGRRRGHRIHYHLIGITSYGV--FCRSSYPSVYTRVSSFLDWIELTVWA 392
            .  |::         :|:.|:.:  .|....|.|...:..|..||..|:.|
Mosquito   221 K--GKQ---------VGVVSWAMAGVCAIGLPDVQASIRYFYGWITKTMAA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 57/239 (24%)
Tryp_SPc 146..386 CDD:214473 56/238 (24%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 58/241 (24%)
Tryp_SPc 35..254 CDD:214473 56/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.