DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:247 Identity:64/247 - (25%)
Similarity:111/247 - (44%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLL 220
            |::.::...|      :.||||:|::|::||||||..     ...|:...:.:.:...:....|.
Mosquito    40 PYLVSITVNS------FVCGGSIIADRWILTAAHCVK-----RNMVKNAAVRVETNNFTASGTLY 93

  Fly   221 RIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL--WVFPELPTTIAFAMGYGATSFAK 283
            ||::..||..|.:..:.||:.||:|...::..|.|:.:.|  .:.|...|......||    .:|
Mosquito    94 RIDRAIAHEKYFRGAFRDDVGLLRLRSPLKFGERVKKIELLSQIVPYNATLTLVGRGY----ISK 154

  Fly   284 P-MTNRLT------NLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYI-LNRDTCQGDSGGP 340
            . .|.::|      |:.|.:....:           |..:....:|.  :: ..:.||.||||||
Mosquito   155 DNKTTKITQMIKAKNIALKLCRKMQ-----------PDFIYPGHLCT--FVKKGKGTCSGDSGGP 206

  Fly   341 LQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTVWA 392
            :...  ||:         :||.|:...|.:.|..|::|:|.||.||:.|:.|
Mosquito   207 VVWY--GRQ---------VGIVSWSKGCGAGYFDVHSRISYFLPWIKATIAA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 61/240 (25%)
Tryp_SPc 146..386 CDD:214473 60/239 (25%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 62/242 (26%)
Tryp_SPc 28..241 CDD:214473 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.