DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005194

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_314093.2 Gene:AgaP_AGAP005194 / 1274900 VectorBaseID:AGAP005194 Length:272 Species:Anopheles gambiae


Alignment Length:285 Identity:62/285 - (21%)
Similarity:110/285 - (38%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 DANDADFDGRVLARPGEYPHMAAVGFESDRGQVD--YKCGGSLISERFVLTAAHCTSIYEAPPKW 200
            |.:||:.:..        |:..::       |:|  ..|.||::.:|::|||.||..:       
Mosquito    36 DGSDAEENAA--------PYQVSL-------QIDGNSTCSGSIVGDRWILTAEHCVPL------- 78

  Fly   201 VRIGDLDLASEKRSVEAQLLR-------------IEQVFAHPNYKKKMYY--------DDIALLK 244
                 |...|| ||...:::.             |::.|.:.|....:.:        :||||::
Mosquito    79 -----LQFFSE-RSNNTRVVAGTNDLKKGGTPYFIDRFFNYDNCSTMLVHTFMFNSTPNDIALIR 137

  Fly   245 LEKEVELTEYVRPVRLW--VFPELPTTIAFAMGY--GATSFAKPMTNRLTNLNLTVVPNAECNAE 305
            |...::..:.|:.:...  ..||..|......|.  ..||.||     |..:|...:....|.| 
Mosquito   138 LTTPLKFNQRVKKIEFTTETVPENATLTLTGWGQMRNGTSPAK-----LQTINAPSIRIDHCRA- 196

  Fly   306 LPPLAETPSGVLESQICAQDYILNR---DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGI--TSYG 365
                ....:.:.:..||:    |::   ..|.||||||  :...|:         |:||  ..:.
Mosquito   197 ----IYNETYLNDGTICS----LSKRGEGACMGDSGGP--VTWKGK---------LVGIFKAVHN 242

  Fly   366 VFCRSSYPSVYTRVSSFLDWIELTV 390
            ..|...:|.::|.|:.:..||:.|:
Mosquito   243 KGCGEGFPDIHTSVAYYYKWIKDTI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 57/272 (21%)
Tryp_SPc 146..386 CDD:214473 56/271 (21%)
AgaP_AGAP005194XP_314093.2 Tryp_SPc 34..266 CDD:238113 61/282 (22%)
Tryp_SPc 34..263 CDD:214473 59/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.