DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP004566

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_313869.5 Gene:AgaP_AGAP004566 / 1274708 VectorBaseID:AGAP004566 Length:327 Species:Anopheles gambiae


Alignment Length:397 Identity:107/397 - (26%)
Similarity:164/397 - (41%) Gaps:95/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRNLSVCLISFIGLWCLSNTHTQRLPPEGRMR---PLQDDSIRSPVDRDIVFPELDAGPGKPEEK 63
            :|.|.:|:   .||..||:..|....||.|..   |.|..:     :::..|.|..||       
Mosquito     1 MRLLILCM---AGLLFLSDLTTGGRIPEDRQALEIPAQGQT-----EKNNPFIEWLAG------- 50

  Fly    64 MWFHITDFQFDRVEGPTQPKPKPRQYPPP---PMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYV 125
                        :.|.|. .|.|....||   ||                      |:...:..:
Mosquito    51 ------------LIGSTS-TPAPENLTPPDSCPM----------------------CKCGRTNRL 80

  Fly   126 ERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC 190
            .||.                |....:..:||.||.:.:..     .:.|||||||:|.|||||||
Mosquito    81 TRIV----------------GGQETQVNQYPWMAMLQYSG-----TFYCGGSLISDRHVLTAAHC 124

  Fly   191 TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYV 255
            ...:......|.:.:.|..|...|: ..:.::.:|..|..|....|..|||:|:|...:.:.:.:
Mosquito   125 VHGFNRNKISVVLMEHDRVSTSESM-TMVSKVLRVIEHNGYNSNNYNSDIAILRLATVMTIEDKL 188

  Fly   256 RPVRLWVFPELPTT--IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG--- 315
            |||.| ..|:.|.|  .....|:||||....::..|..:.:.::.||:|.       :|..|   
Mosquito   189 RPVCL-PTPKKPFTGYDGIVTGWGATSENGAISTNLQEVTVPIMSNADCR-------KTGYGASR 245

  Fly   316 VLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRV 379
            :.::.:||......:|:||||||||  |::..:.....:| .:.||.|:|..| :.:||.|||||
Mosquito   246 ITDNMLCAGYDEGKKDSCQGDSGGP--LHVIKQNSTDNVH-QIAGIVSWGEGCAKPNYPGVYTRV 307

  Fly   380 SSFLDWI 386
            :.|..||
Mosquito   308 NRFGTWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/247 (32%)
Tryp_SPc 146..386 CDD:214473 77/245 (31%)
AgaP_AGAP004566XP_313869.5 Tryp_SPc 82..314 CDD:214473 79/264 (30%)
Tryp_SPc 83..317 CDD:238113 80/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.