DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPC2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_313588.3 Gene:CLIPC2 / 1274460 VectorBaseID:AGAP004317 Length:383 Species:Anopheles gambiae


Alignment Length:320 Identity:109/320 - (34%)
Similarity:159/320 - (49%) Gaps:32/320 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DRVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAAD 138
            :|::....|..:.|.|......|..|.....|....:.|.|..|            |.|..:.. 
Mosquito    80 ERLQQLNDPNQRCRDYQSASNSGLLFGSLAVGSSVVKLKPRAQC------------PTDQNLIV- 131

  Fly   139 ANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI 203
                   |...||.||:||||.:....:.|.:.::||.:||||::|:|||||   .|:....||:
Mosquito   132 -------GGTAARFGEFPHMARLAMPDENGAMVFRCGATLISEQWVMTAAHC---LESQTIVVRL 186

  Fly   204 GDLDLASEK--RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL 266
            |:|...:::  ..|:.|:.||.:   |||||.:..|:|||||||.:.|..:..:||..|:....:
Mosquito   187 GELKEGNDEFGDPVDVQVTRIVK---HPNYKPRTVYNDIALLKLARPVTFSMRIRPACLYGSSTV 248

  Fly   267 PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRD 331
            ..|.|.|:|:|:|......:..|..::|.|...|.|:.........|.|:.||.:||......||
Mosquito   249 DRTKAVAIGFGSTEAYGAASKELLKVSLDVFTTAACSVFFQRNRRVPQGLRESHLCAGFLSGGRD 313

  Fly   332 TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTVW 391
            ||.||||||||::    .........:|||||:|:.|.|:.|.:|||||.::||||..||
Mosquito   314 TCTGDSGGPLQIS----SEDEACVAQIIGITSFGIGCGSTTPGIYTRVSEYIDWIEGIVW 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 93/242 (38%)
Tryp_SPc 146..386 CDD:214473 92/241 (38%)
CLIPC2XP_313588.3 Tryp_SPc 130..367 CDD:238113 95/254 (37%)
Tryp_SPc 130..364 CDD:214473 92/251 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BNNF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.