DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPB2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:285 Identity:91/285 - (31%)
Similarity:134/285 - (47%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSI 193
            ||..........|....|:. ....|:|..|.:.:.....|.|:.|||:||:.|::||||||  :
Mosquito    89 FPTSPECGIQVTDRIIGGQT-TELEEFPWTALIEYRKPGNQYDFHCGGALINARYILTAAHC--V 150

  Fly   194 YEAPPKW----VRIGDLDLASEKRSVEAQL------LRIEQVFAHPNY--KKKMYYDDIALLKLE 246
            ...|..|    ||:|:.||::.....:...      |.||...||..|  ....:.:||||::|.
Mosquito   151 QSLPRGWQLNGVRLGEWDLSTANDCSDGICSAGPIDLEIESFVAHAGYDAADTAHTNDIALIRLR 215

  Fly   247 KEVELTEYVRPVRL-WVFPELPT----TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAEL 306
            ::|..:|.:||:.| ...|:...    |::||.|:|.|..|.....:| .:.|||...:.|.   
Mosquito   216 QDVASSEMIRPICLPLTEPQRSRNRVGTVSFAAGWGKTESASASERKL-KVELTVQDPSRCR--- 276

  Fly   307 PPLAETPSGV----LESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF 367
                :...|:    ..||:||.. :..:|||.|||||||.....|.       ::|||:.|:|:.
Mosquito   277 ----QIYRGINIALKASQMCAGG-LQGKDTCTGDSGGPLMAKSAGA-------WYLIGVVSFGLS 329

  Fly   368 -C-RSSYPSVYTRVSSFLDWIELTV 390
             | .:.||.|||.|..:|||||..|
Mosquito   330 KCGTAGYPGVYTNVVEYLDWIESNV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 85/263 (32%)
Tryp_SPc 146..386 CDD:214473 84/262 (32%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855
Tryp_SPc 102..350 CDD:214473 84/266 (32%)
Tryp_SPc 103..353 CDD:238113 87/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.