DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPB8

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_312743.1 Gene:CLIPB8 / 1273740 VectorBaseID:AGAP003057 Length:405 Species:Anopheles gambiae


Alignment Length:314 Identity:89/314 - (28%)
Similarity:132/314 - (42%) Gaps:60/314 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YSE-YV-ERIFPNDTAVAADANDAD----------FDGRVLARPGEYPHMAAVGFESDRGQVDYK 173
            |.| || |.:.|.:...:..|.|||          ..|..||...|:|.||.:.:|.|...:...
Mosquito   102 YREPYVNETMVPKNRVASRIAFDADSCGIQSYVAKIRGGQLAEIDEFPWMAMLLYERDNNALTQG 166

  Fly   174 CGGSLISERFVLTAAHCTS-----IYEAPPKWVRIGDLDLASEKRSVEAQLLR----------IE 223
            |||:|||..:|:|||||.:     ..:...|:||:.:.::.:....|....|:          .:
Mosquito   167 CGGALISRTYVITAAHCVTGKNFQQTKGRLKFVRLREYNIHTNPDCVYENDLKDCSDDMIDLVPQ 231

  Fly   224 QVFAHPNY--KKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE-------LPTTIAFAMGYGAT 279
            .|..||.|  :......||||:::|:....|:::|.:.|   ||       .|.......|:|.|
Mosquito   232 AVIPHPEYDSESSNQQHDIALIRIEQTPPFTDFLRSICL---PEQNFESSATPGKKLSVSGWGRT 293

  Fly   280 SFAKP------MTNRLTNLNLTVVPNAECNAELPP--LAETPSGVLESQICAQDYILNRDTCQGD 336
            ...|.      ::.....|:|..|...:|:....|  .|..|     .|:||... ..:|||.||
Mosquito   294 DIFKDNLGPDVLSPIKLKLSLPYVEREKCSKTFRPWSFALGP-----GQMCAGGE-RAKDTCAGD 352

  Fly   337 SGGPLQLNLPGRRRGHRIHYHLIGITSYGV-FCR-SSYPSVYTRVSSFLDWIEL 388
            ||.||.     .....|..:::.||.|.|| .|. ...|.|||.|..:|.||::
Mosquito   353 SGSPLM-----SYDMKRAIWYITGIVSLGVRGCGVEGLPGVYTNVHHYLPWIKM 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/274 (28%)
Tryp_SPc 146..386 CDD:214473 77/273 (28%)
CLIPB8XP_312743.1 CLIP 41..95 CDD:288855
Tryp_SPc 136..399 CDD:214473 77/276 (28%)
Tryp_SPc 139..400 CDD:238113 78/274 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.