DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP002543

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_312395.5 Gene:AgaP_AGAP002543 / 1273420 VectorBaseID:AGAP002543 Length:274 Species:Anopheles gambiae


Alignment Length:269 Identity:71/269 - (26%)
Similarity:113/269 - (42%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ANDADFDGRVLARPGEYPHMAAV--------GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYE 195
            |:|:...|.:.|.. ..|:..::        ||...|..  :.||||:::|.:|:|||||....:
Mosquito    23 ADDSKIVGGMTANE-RIPYQISLQVLVSSFFGFGPKRWM--HNCGGSIVNEYYVVTAAHCLDGMD 84

  Fly   196 APPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL 260
            .....:..|..||.::  |.:.....:|....||:| .::...||.::::::.....|.|:|:|.
Mosquito    85 INRMSIVAGTNDLRND--SSKGTRYFLESYMIHPDY-IELNRSDIGVMRVKEAFTFNENVQPIRY 146

  Fly   261 WVFPELPTTIAFAMGYGAT------SFAKPM-----TNRLTNLNLTVVPNAECNAELPPLAETPS 314
                     .:..:|.|.|      .:..|:     ...|....||.:.|.:|.....|:..|  
Mosquito   147 ---------SSDFVGGGVTCLLTGWGYTMPIRVGSTPKDLQEAELTTITNDQCRERGMPVNPT-- 200

  Fly   315 GVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGV-FCRSSYPSVYTR 378
                 :||....: .:..|.|||||||..|           ..|.|:.|||. :|....|.||||
Mosquito   201 -----EICTFTRV-GQGACGGDSGGPLVCN-----------NQLSGVVSYGTRYCGIGVPDVYTR 248

  Fly   379 VSSFLDWIE 387
            ||.|..||:
Mosquito   249 VSEFDSWIQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/260 (26%)
Tryp_SPc 146..386 CDD:214473 67/259 (26%)
AgaP_AGAP002543XP_312395.5 Tryp_SPc 27..256 CDD:214473 67/262 (26%)
Tryp_SPc 28..259 CDD:238113 69/264 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.