DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:264 Identity:100/264 - (37%)
Similarity:139/264 - (52%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VAADANDADFDGRVLARPGEYPHMAAVG---FESDRGQ----VDYKCGGSLISERFVLTAAHCTS 192
            |..|:..||          |:||||.:|   .::|.|.    .::.|||:|||:|||||||||..
Mosquito    27 VGGDSATAD----------EFPHMAVLGRSCLQADGGDCVDGYEWFCGGTLISDRFVLTAAHCAH 81

  Fly   193 I-YEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVR 256
            . ...||..|::|..||..     .|..:.:..|..||.|...:.|:||||::||..|  ...::
Mosquito    82 TGMSHPPTVVQLGAHDLRR-----PALYVGVRDVVLHPGYGGVLAYNDIALIRLESPV--ASSIQ 139

  Fly   257 PVRLWVFPELPTTI-AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ 320
            |..||....:|..: ..|.|:|.....:..:..|..:.:.:|||::||..|........|||.||
Mosquito   140 PALLWRSETIPENVPLIATGWGKLGHFEDPSMILQRVQIPIVPNSQCNQLLYRSRRLRHGVLPSQ 204

  Fly   321 ICAQDYILNRDTCQGDSGGPLQLNLPGRRR-GHRIHYHLIGITSYGVFCRS-SYPSVYTRVSSFL 383
            :||.|....:|||:|||||||||.||..|. |....|:::||||.|..|.: ..|.:||||||:.
Mosquito   205 LCAGDPNGGKDTCEGDSGGPLQLKLPSARPIGQAYRYYVVGITSNGGICGTVDRPGLYTRVSSYA 269

  Fly   384 DWIE 387
            .||:
Mosquito   270 GWID 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 95/251 (38%)
Tryp_SPc 146..386 CDD:214473 94/250 (38%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 100/264 (38%)
Tryp_SPc 26..272 CDD:214473 98/261 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BNNF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.