DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP010692

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_311408.4 Gene:AgaP_AGAP010692 / 1272495 VectorBaseID:AGAP010692 Length:271 Species:Anopheles gambiae


Alignment Length:255 Identity:64/255 - (25%)
Similarity:109/255 - (42%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VAADAN-DADFDGRVL-ARPGE---YPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIY 194
            ::.|.| ::...||:: .:.|.   :|::..:..:::    .| ||.::|:...|.|||||....
Mosquito    33 ISVDINTNSSHSGRIINGKQGNIATFPYIVRMRVKNE----GY-CGATIITYWHVFTAAHCVYHI 92

  Fly   195 EAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVR 259
            |.|......|    .|..::....:....::..||.|.......|.|::::....:..:.:.|:.
Mosquito    93 EDPATITMYG----GSASQTSGGVVFFPSKIVIHPQYNSSTLDYDAAIIRVNNTFQGYKNIAPIA 153

  Fly   260 LWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLN-LTVVPNAECNAELPPLAETPSGVLESQICA 323
            |.|......|..:.:|:|.|.:|...|..:.... |.|||..:|       |.....|.:..|||
Mosquito   154 LQVSDVPVKTKCYVIGWGWTQYATKATPDIMQYAILQVVPVKKC-------ASAYIYVPKDFICA 211

  Fly   324 QDYILNR-DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY-GVFCRSSYPSVYTRVSS 381
              :..|. |.|.||||||....  |:         |.|.||: |..|:...||.:|::|:
Mosquito   212 --FQGNGVDICHGDSGGPFVCE--GK---------LAGATSFVGPGCQGQIPSGFTKISA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 62/243 (26%)
Tryp_SPc 146..386 CDD:214473 62/243 (26%)
AgaP_AGAP010692XP_311408.4 ATP-synt_C <9..36 CDD:294318 0/2 (0%)
Tryp_SPc 46..258 CDD:214473 60/240 (25%)
Tryp_SPc 47..268 CDD:238113 60/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.