DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPC4

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_310504.4 Gene:CLIPC4 / 1271649 VectorBaseID:AGAP000573 Length:376 Species:Anopheles gambiae


Alignment Length:308 Identity:100/308 - (32%)
Similarity:149/308 - (48%) Gaps:46/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDAD-FDGRVL-ARPGEYPHMAA 160
            |...|..|.........|:.:|:...:          .:|.||..| ..||.: |..||:|.:|.
Mosquito    97 PTEAPGTGDGTSNRFTARIAKQECERF----------TSASANIIDHISGRAIEALRGEFPFVAL 151

  Fly   161 VGFESDRGQVDYK---CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLA-SEKRSVEAQLLR 221
            |.|..:.|: :.|   ||.|||:.||:||||||  :.:..|..|.||.:.|: :||...|     
Mosquito   152 VNFRGEEGE-EVKLTRCGASLIAPRFLLTAAHC--LKDLNPVTVEIGFIQLSDTEKDEYE----- 208

  Fly   222 IEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV-----RLWVFPELPTTIAFAMGYGATSF 281
            |:||..|..:|.:.  :||||::|:..|...:.|.|:     |..:.|.:..|:   ||:||...
Mosquito   209 IKQVHLHEGHKSRR--NDIALIELKNNVTYKQDVGPICLNTDRPEIGPSINLTV---MGWGADGD 268

  Fly   282 AKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILN---RDTCQGDSGGPLQL 343
            .: ..::|....:..:|..||...... |:....:.|.|:||....:|   .|.|||||||||.:
Mosquito   269 GQ-RADKLMKGTVYEIPLDECVQRFRD-AKQRISLGEDQLCALGEKVNDETTDACQGDSGGPLVM 331

  Fly   344 NLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTVW 391
            .:       |..::|:|:.|.|..|..|.|.:|||||.:|:|||..||
Mosquito   332 TV-------RQKFYLVGVVSTGAVCGGSLPGIYTRVSRYLEWIEQRVW 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 87/253 (34%)
Tryp_SPc 146..386 CDD:214473 86/252 (34%)
CLIPC4XP_310504.4 Tryp_SPc 140..369 CDD:238113 86/250 (34%)
Tryp_SPc 140..367 CDD:214473 84/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.