DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP003807

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_310364.7 Gene:AgaP_AGAP003807 / 1271545 VectorBaseID:AGAP003807 Length:278 Species:Anopheles gambiae


Alignment Length:279 Identity:79/279 - (28%)
Similarity:126/279 - (45%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KYSEYVERIFPNDTAVAADANDADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLIS 180
            |:..:.:.||......|.........||::    |..|::||..::    .|....:.||||:|.
Mosquito    27 KFERFAQSIFSTVNRAAVLPASGSKGGRIVGGYDATEGQFPHQVSL----RRPPNFHFCGGSIIG 87

  Fly   181 ERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKL 245
            .|::::|.|||...|.....|.:|.:.|||  ..|..:.:||..   ||.|......:||:|::.
Mosquito    88 PRWIISATHCTIGMEPANLNVYVGSVKLAS--GGVYYRTMRIVN---HPLYDPNTIENDISLIQT 147

  Fly   246 EKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLA 310
            .:.:...|:.:|:.|.....:..|.|...|:|.::.   :.:.|..:|:.::...||.||.|   
Mosquito   148 VQPIVFNEHTQPIGLASTNLISATGASISGWGRSNV---ILDNLQYMNVNILTMEECRAERP--- 206

  Fly   311 ETPSG-VLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY-GVFCRSSYP 373
              .|| :.:|.||... ...:..|.|||||||..:       ..:|    ||.|: .|.|.:...
Mosquito   207 --GSGNIFDSVICVSS-PFGQGACSGDSGGPLIYD-------GMLH----GIASFVRVPCATEVS 257

  Fly   374 SVYTRVSSFLDWI-ELTVW 391
            .||.||.|.|.|| .:|:|
Mosquito   258 DVYERVYSHLSWIASVTLW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/247 (30%)
Tryp_SPc 146..386 CDD:214473 71/245 (29%)
AgaP_AGAP003807XP_310364.7 Tryp_SPc 54..270 CDD:214473 70/244 (29%)
Tryp_SPc 55..273 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.