DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP003748

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_310280.7 Gene:AgaP_AGAP003748 / 1271480 VectorBaseID:AGAP003748 Length:547 Species:Anopheles gambiae


Alignment Length:282 Identity:101/282 - (35%)
Similarity:148/282 - (52%) Gaps:22/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 EQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDR----GQVDYKCGGSL 178
            |..|.....|.:..|  |::......|.|| .|...|:|||||:|: :|:    ..|.|||||||
Mosquito    31 EGYYDHCPSRFYSED--VSSALGFFIFGGR-RAFLKEFPHMAAIGW-TDKTVSPPVVQYKCGGSL 91

  Fly   179 ISERFVLTAAHC-------TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMY 236
            |:.::|||||||       ..|...||..||:||.:||:.:....||..:|.....|..:||...
Mosquito    92 IAAKYVLTAAHCKVDDEKYVFIRVIPPDTVRLGDTNLATTEDDETAQQFKIVSFAVHEKFKKNRK 156

  Fly   237 YDDIALLKLEKEVELTEYVRPVRLWVFPELP--TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPN 299
            |.||||::|::|.:....|.|:.||....:.  ::...|:|:|.|::...|:..|..::|....:
Mosquito   157 YYDIALIELDREAKFNTAVCPICLWPLDNIHEYSSSLRAIGFGFTTYTSGMSPTLQKVSLNYYDS 221

  Fly   300 AECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY 364
            ..||.|||..|....|:...|.|.:  ..::|.|.||||||||::|....|  .|.| |.|:.|:
Mosquito   222 DSCNNELPKDARLRYGLTSDQFCTK--TPHKDACLGDSGGPLQIDLSDVTR--TIPY-LTGVVSF 281

  Fly   365 GVFCRSSYPSVYTRVSSFLDWI 386
            |..|......|||:|:|:::||
Mosquito   282 GTGCWDGSMGVYTKVASYINWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 95/254 (37%)
Tryp_SPc 146..386 CDD:214473 93/252 (37%)
AgaP_AGAP003748XP_310280.7 Tryp_SPc 54..305 CDD:238113 96/257 (37%)
Tryp_SPc 54..303 CDD:214473 94/255 (37%)
Trypsin 316..521 CDD:278516
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.