DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP006707

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_309036.1 Gene:AgaP_AGAP006707 / 1270350 VectorBaseID:AGAP006707 Length:255 Species:Anopheles gambiae


Alignment Length:251 Identity:75/251 - (29%)
Similarity:122/251 - (48%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLAS 210
            |..:|:.|..|:..::.....    .:.|||||::.|:|||||||...:|.....|.:|...|..
Mosquito    33 GGEVAKNGSAPYQVSLQIPGH----GHNCGGSLLNSRWVLTAAHCIVGHEPTNIQVLVGTNSLKE 93

  Fly   211 EKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE--LPTTIAFA 273
                 ..||.:.:::| |.||....:.:||.|::|::||:.:|.|:.:.   :.|  :|..:...
Mosquito    94 -----GGQLYKPDKLF-HHNYASPEFRNDIGLIRLKEEVQFSEIVQSIE---YSEQVVPANVTVR 149

  Fly   274 M-GYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRD---TCQ 334
            : |:|.||....:...|.:||:..:.|.:|.|:    :..|..|....:|.    |:|.   .|.
Mosquito   150 LTGWGRTSAGGSVPTLLQSLNVVTLTNEDCKAK----SLYPEHVDVGHLCT----LSRSGEGACN 206

  Fly   335 GDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTV 390
            |||||||...  |:         |:|:.::||.|...||..:.|||.:.|||..|:
Mosquito   207 GDSGGPLVYE--GK---------LVGVVNFGVPCGLGYPDGFARVSYYHDWIRTTM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/246 (30%)
Tryp_SPc 146..386 CDD:214473 72/245 (29%)
AgaP_AGAP006707XP_309036.1 Tryp_SPc 30..247 CDD:214473 72/245 (29%)
Tryp_SPc 31..250 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.