DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CTR1_ANOGA

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_309033.2 Gene:CTR1_ANOGA / 1270348 VectorBaseID:AGAP006709 Length:259 Species:Anopheles gambiae


Alignment Length:286 Identity:80/286 - (27%)
Similarity:127/286 - (44%) Gaps:79/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 YVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQV---DYKCGGSLISERFVL 185
            ||.|:.                |..:|:.|..|:..::       ||   .:.|||||:::|:||
Mosquito    29 YVNRVV----------------GGEVAKNGSAPYQVSL-------QVPGWGHNCGGSLLNDRWVL 70

  Fly   186 TAAHCTSIYEAPPKWVRIGDLDLASEKRSVE--AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKE 248
            |||||. :..||      |||.:.....|::  .:||:::::..|..|....:::||.|::||:.
Mosquito    71 TAAHCL-VGHAP------GDLMVLVGTNSLKEGGELLKVDKLLYHSRYNLPRFHNDIGLVRLEQP 128

  Fly   249 VELTEYVRPVRLWVFPE--LPTTIAFAM-GYGATSFAKPMTNRLTNLNLTVVPNAECN------- 303
            |..:|.|:.|.   :.|  :|......: |:|.||...|....|.:||:..:.|.:||       
Mosquito   129 VRFSELVQSVE---YSEKAVPANATVRLTGWGHTSANGPSPTLLQSLNVVTLSNEDCNKKGGDPG 190

  Fly   304 ----AELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY 364
                ..|..|.:|..|                .|.|||||||...  |:         |:|:.::
Mosquito   191 YTDVGHLCTLTKTGEG----------------ACNGDSGGPLVYE--GK---------LVGVVNF 228

  Fly   365 GVFCRSSYPSVYTRVSSFLDWIELTV 390
            ||.|...||..:.|||.:.||:..|:
Mosquito   229 GVPCALGYPDGFARVSYYHDWVRTTM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/259 (29%)
Tryp_SPc 146..386 CDD:214473 75/258 (29%)
CTR1_ANOGAXP_309033.2 Tryp_SPc 32..250 CDD:214473 76/277 (27%)
Tryp_SPc 33..253 CDD:238113 76/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.