DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP007043

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001237132.2 Gene:AgaP_AGAP007043 / 1270058 VectorBaseID:AGAP007043 Length:575 Species:Anopheles gambiae


Alignment Length:264 Identity:68/264 - (25%)
Similarity:120/264 - (45%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPK--WVRIGDLDLAS 210
            ::|.||::|...|:.......:..||||||:||:.|||:||||  |.|..|.  :::.|...|.:
Mosquito    51 IIAEPGDWPWHVALFAHMKSEKPAYKCGGSIISQHFVLSAAHC--IKEPNPDHYFLKAGIHHLNN 113

  Fly   211 EKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEY-VRPVRLWVFPELPTTI---- 270
            : ......:..:.::..||.|.:..:|:||||::.::.:....: :.|:.||  |....|:    
Mosquito   114 D-NDTSVVVYNLFEIILHPKYDRHTFYNDIALMRPDRAISFASFSIFPICLW--PTHNATLIDVL 175

  Fly   271 ---AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPP-LAETPSGVLESQICAQDYILNRD 331
               ..|:|:|.....: ::..|...::.|:...:|..:||. :...|...  .::||.......:
Mosquito   176 SRSGIAVGFGFDETHR-ISETLQQASMKVIEKQQCIEQLPEHVRFLPQDA--GKMCAIGTESGAN 237

  Fly   332 TCQGDSGGPL-----QLNLPGRRRGHRIHYHLIGITSYG---------VFCRSSYPSVYTRVSSF 382
            .|.|||||.|     |:            ::|.||.|..         ..|.::.|:.||.|:.:
Mosquito   238 VCSGDSGGGLYFAKDQV------------WYLRGIVSAAARRDLDTGEATCNAALPATYTDVAQY 290

  Fly   383 LDWI 386
            ..||
Mosquito   291 TTWI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/264 (26%)
Tryp_SPc 146..386 CDD:214473 66/262 (25%)
AgaP_AGAP007043XP_001237132.2 Tryp_SPc 50..297 CDD:238113 68/264 (26%)
Tryp_SPc 50..294 CDD:214473 66/262 (25%)
Tryp_SPc 330..573 CDD:304450
Tryp_SPc 330..570 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.