DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP007165

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_308603.4 Gene:AgaP_AGAP007165 / 1269949 VectorBaseID:AGAP007165 Length:275 Species:Anopheles gambiae


Alignment Length:285 Identity:72/285 - (25%)
Similarity:114/285 - (40%) Gaps:56/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IFPNDTAVAADAN-----DADFDGRVLARPGEYPHMAAV----GFESDRGQVDYKCGGSLISERF 183
            :.|....||...|     :...:||. |..|::||.|.:    |.|..|     .|.|:|:.|:.
Mosquito    14 VLPAAEIVALHCNPSGSENVTANGRP-AYAGQFPHHALLVVRFGEEETR-----HCSGALVDEKH 72

  Fly   184 VLTAAHC---TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKL 245
            |:|.|.|   :|..|     |.:|...|.:::......:....:......|..:.:.:|:|:::.
Mosquito    73 VVTVAQCVVGSSSVE-----VHLGSNCLLADESDKFRYVFTAVEFTVRDGYDTETFVNDVAVVRF 132

  Fly   246 EKE-VELTEYVRPVRL-------WVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAEC 302
            ..| |.|..:|:||||       :|..|:.|:....|.||....|    :.|..:.|.|:....|
Mosquito   133 TDEAVRLPPWVKPVRLPEADEDQYVGQEVVTSGYGLMDYGTDGAA----DGLQYMRLVVLELEAC 193

  Fly   303 NAE----LPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITS 363
            .||    :|.         ..:.|||:....|: |..|.|.||.     |:.|....|.|:|:||
Mosquito   194 QAEFDFVMPG---------TGRFCAQEADHERN-CVSDVGSPLV-----RKEGRLQEYVLLGLTS 243

  Fly   364 YG--VFCRSSYPSVYTRVSSFLDWI 386
            :|  ..|....|.....:.....|:
Mosquito   244 FGQKFACSQGNPGALQEMREHATWV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/262 (26%)
Tryp_SPc 146..386 CDD:214473 67/260 (26%)
AgaP_AGAP007165XP_308603.4 Tryp_SPc 36..256 CDD:214473 66/249 (27%)
Tryp_SPc 36..256 CDD:238113 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.