DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP012692

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_307636.4 Gene:AgaP_AGAP012692 / 1269055 VectorBaseID:AGAP012692 Length:277 Species:Anopheles gambiae


Alignment Length:242 Identity:68/242 - (28%)
Similarity:103/242 - (42%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDL 206
            ||::    |....||::..:...|..     .||.|:|:...|.|||||....:.|......|  
Mosquito    50 GRIVNGKNANIASYPYIVRLRVNSAG-----VCGASIITYTHVFTAAHCLYKNQNPASITLYG-- 107

  Fly   207 DLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT-TI 270
              .|..::....:....:|..||.|..:.:..|..:::::...:..:.:.|:.| ...|:|: |.
Mosquito   108 --GSTSQTSGGVVFFASKVIIHPYYNPETHNYDAGIVQIKNSFQGYKNIAPIAL-QDAEVPSDTT 169

  Fly   271 AFAMGYGATSF-AKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ-ICAQDYILNRDTC 333
            .:|.|:|..:: .|...:.|....|.|:...:|:|..       ||....| ||||.. .|.|.|
Mosquito   170 CYAAGWGYNNYDRKTSPDNLQYATLQVISPQQCSAAW-------SGYATPQFICAQQN-NNGDVC 226

  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSY-GVFCRSSYPSVYTRV 379
            .||||||...|           ..|.|.||| ||.||...||.:|:|
Mosquito   227 NGDSGGPFVCN-----------DKLTGATSYGGVACRGKLPSAFTKV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/242 (28%)
Tryp_SPc 146..386 CDD:214473 68/242 (28%)
AgaP_AGAP012692XP_307636.4 Tryp_SPc 51..264 CDD:214473 67/241 (28%)
Tryp_SPc 52..274 CDD:238113 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.