DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CLIPA3

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_024667072.1 Gene:CLIPA3 / 1268922 VectorBaseID:AGAP012591 Length:422 Species:Anopheles gambiae


Alignment Length:294 Identity:81/294 - (27%)
Similarity:124/294 - (42%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYP-HMAAVGFESDRGQVDYKCGGSLIS 180
            |..:|.       |...:.|..||.|.:        |||| .:..:|    .|.| |...|:||.
Mosquito   166 CGMQYP-------PIANSPAVTANQAAY--------GEYPWQVVLLG----PGDV-YVGSGALID 210

  Fly   181 ERFVLTAAHCTSIYEAPPK--WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALL 243
            ...||||||..|.|.:..:  .||:|:.|.||....:..|...:.:.|.||::......:|||:|
Mosquito   211 NLHVLTAAHKISDYTSGTRALKVRLGEWDAASTTEPLPVQEFTVARYFVHPSFTAANLRNDIAIL 275

  Fly   244 KLEKEVEL-------------TEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRL-TNLNL 294
            :|...|.|             |.:|.. |.||           .|:|...|.......: ..:::
Mosquito   276 RLSGTVALGTTPTIATACLPVTSFVGS-RCWV-----------SGWGKNDFVSGAFQSIPKEVDV 328

  Fly   295 TVVPNAECNAELPPLAETPSGVLE--SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYH 357
            .:|.:|.|...|.......:.||:  |.:||... |.:|.|.||.|.||...|..|       ::
Mosquito   329 PIVNSANCQTALRTTRLGGNFVLDTTSFLCAGGE-LGKDACTGDGGSPLVCALNNR-------WY 385

  Fly   358 LIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            ::|:.::|:.| .:..|.||..|:|::.||..|:
Mosquito   386 VVGLVAWGIGCGANGIPGVYVNVASYITWITSTI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/260 (28%)
Tryp_SPc 146..386 CDD:214473 71/259 (27%)
CLIPA3XP_024667072.1 Tryp_SPc 182..418 CDD:238113 75/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.