DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP012736

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_307014.4 Gene:AgaP_AGAP012736 / 1268455 VectorBaseID:AGAP012736 Length:340 Species:Anopheles gambiae


Alignment Length:268 Identity:72/268 - (26%)
Similarity:103/268 - (38%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPP---KWVR 202
            :.|..|.:....|....:..|.|.|.||     |            .|...|:|....   .||.
Mosquito   120 NGDSGGPLTVESGGPIQIGVVSFVSIRG-----C------------EAGMPSVYSRVSFYLNWVE 167

  Fly   203 IGDLDLASEKRSVEAQLLRIEQ--VFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE 265
            |..          :.|.:|...  :..||.|......:|:||:.|...:..|..|:|:.|   |.
Mosquito   168 INS----------DFQRIRFTSTGIRRHPEYDDTSLRNDVALILLNSPMTFTSRVKPISL---PA 219

  Fly   266 LPTTIAF------AMGYGATSFAKPMTNRLTNLNLT---VVPNAECNAELPPLAETPSGVLESQ- 320
            ...|..|      ..|:|.:|.|.|..:.:  |..|   ::..|||      :......:.:|| 
Mosquito   220 RTDTRQFEGFTGTVSGFGRSSDASPYPSSI--LRFTSNPIMSKAEC------IVSWGFALAQSQN 276

  Fly   321 ICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG--VFCRSSYPSVYTRVSSFL 383
            :|.:. ...|.:|.|||||||.:|..|..:        ||..|:|  ..|.|.:||:|.|||.||
Mosquito   277 VCLKP-TGGRSSCNGDSGGPLTVNSGGVLQ--------IGTVSFGSSYGCASGWPSMYARVSYFL 332

  Fly   384 DWIELTVW 391
            .||...:|
Mosquito   333 SWINENIW 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/257 (27%)
Tryp_SPc 146..386 CDD:214473 68/256 (27%)
AgaP_AGAP012736XP_307014.4 Tryp_SPc <7..167 CDD:238113 13/63 (21%)
Tryp_SPc <7..166 CDD:214473 12/62 (19%)
Tryp_SPc <168..335 CDD:214473 55/196 (28%)
Tryp_SPc <169..338 CDD:238113 56/198 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.