DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP012614

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_306194.4 Gene:AgaP_AGAP012614 / 1267637 VectorBaseID:AGAP012614 Length:393 Species:Anopheles gambiae


Alignment Length:119 Identity:44/119 - (36%)
Similarity:67/119 - (56%) Gaps:14/119 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW----VRIGDLDLAS---- 210
            |:|..|.:.|:...|...:.||||||::|:::|||||  |...|..|    ||:|:.|||:    
Mosquito   268 EFPWTALIEFQKPDGSFGFHCGGSLINDRYIVTAAHC--IKSIPRDWKVQRVRLGEWDLATANDC 330

  Fly   211 -EKRSVEAQL-LRIEQVFAHPNY--KKKMYYDDIALLKLEKEVELTEYVRPVRL 260
             .:...:|.: |.|||:..|..|  |.|...:||||::..:.|..::.|||:.|
Mosquito   331 QNEFCSDAPIDLDIEQIVVHTGYDTKDKSNANDIALIRFTRPVNYSQTVRPICL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 44/119 (37%)
Tryp_SPc 146..386 CDD:214473 44/119 (37%)
AgaP_AGAP012614XP_306194.4 Tryp_SPc <1..149 CDD:214473
Tryp_SPc <1..149 CDD:238113
Tryp_SPc 261..>389 CDD:304450 44/119 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.