DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC116408674

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031752209.1 Gene:LOC116408674 / 116408674 -ID:- Length:392 Species:Xenopus tropicalis


Alignment Length:224 Identity:64/224 - (28%)
Similarity:107/224 - (47%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DYKCGGSLISERFVLTAAHC----TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNY 231
            ::.|.|::::.:::.|||||    ....:.....|.:| ..|.|||.. ..|:|.::|:..|..|
 Frog     5 EHICTGTVLNNQWIFTAAHCFRHLNGENDIKSLQVVLG-AHLLSEKEK-HIQVLNVKQIIQHELY 67

  Fly   232 KKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL--PTTIAFAMGYGATSFAKPMTNRLTNLNL 294
            ..|:.|.||||::|.|.|:|.:||:|..|.:....  |.|..:..|:|...........:..:.:
 Frog    68 DPKVQYYDIALIQLNKPVQLNDYVQPACLPMSSATLEPLTECYLAGWGVRDEGDEPVAIMQEVKV 132

  Fly   295 TVVPNAECNAELPPLAETPSGVL-ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHL 358
            ..:.:..||       :|..|.: |..:||... .|..:|||||..||..    :|:...| :.:
 Frog   133 ERINSKRCN-------KTYLGAIQEYHLCASQK-ANMKSCQGDSAAPLMC----KRKTSTI-FSV 184

  Fly   359 IGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            |||.|:|..| :.:.|.:||....|:.|:
 Frog   185 IGIASWGSGCSQINSPGIYTSTKDFVKWM 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 64/224 (29%)
Tryp_SPc 146..386 CDD:214473 63/222 (28%)
LOC116408674XP_031752209.1 Tryp_SPc 2..212 CDD:238113 63/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.