DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC116407774

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_031749650.1 Gene:LOC116407774 / 116407774 -ID:- Length:319 Species:Xenopus tropicalis


Alignment Length:236 Identity:81/236 - (34%)
Similarity:113/236 - (47%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHC-------TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNY 231
            ||||||:.::|::||||       :||.      |.:|.. :.||....|.: :.:.::..||.|
 Frog    58 CGGSLINNKWVVSAAHCINNPSDLSSIV------VFLGSY-MLSEPNQQEIR-VAVMRIIVHPRY 114

  Fly   232 KKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTI-----AFAMGYGATSFAKPMTNR--L 289
            .|....:||:||:||.||.||:.:.||.|   |....|.     .:|.|:||.....|:.|.  |
 Frog   115 DKYSSINDISLLELENEVVLTDAIIPVCL---PTAAVTFPTGLKCWATGWGAILPGVPLPNPKIL 176

  Fly   290 TNLNLTVVPNAECNAELPPLAETPSGVL----ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRR 350
            ..:.|.::.:..|:...    .|||...    ...|||......:|||||||||||..:...|  
 Frog   177 QEVALPMIDSQTCSQYF----STPSTKAAISPNLMICAGYIDGGKDTCQGDSGGPLVCSENNR-- 235

  Fly   351 GHRIHYHLIGITSYGVFCRSSY-PSVYTRVSSFLDWIELTV 390
                 ::|.||.|||..|...| |.|.|.:..|:.|||.||
 Frog   236 -----WYLGGIVSYGASCGKPYRPGVNTFLPPFIGWIESTV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/231 (33%)
Tryp_SPc 146..386 CDD:214473 76/230 (33%)
LOC116407774XP_031749650.1 Tryp_SPc 32..270 CDD:238113 79/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.